SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024007 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024007
Domain Number 1 Region: 4-435
Classification Level Classification E-value
Superfamily ALDH-like 4.06e-132
Family ALDH-like 0.00000000000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024007   Gene: ENSGGOG00000007682   Transcript: ENSGGOT00000022174
Sequence length 455
Comment pep:known_by_projection chromosome:gorGor3.1:5:59910392:59920865:1 gene:ENSGGOG00000007682 transcript:ENSGGOT00000022174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKISEAVKRARAAFSSGKTRPLQFRIQQLEALRRLIQEQEQELVGALAADLHKNEWNAY
YEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNL
TIQPMVGAIAAGNAVVLKPSELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKER
FDHILYTGSTGVGKIIMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKFMNS
GQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRIISARHFQRVMGLIEG
QKVAYGGTGDVATRYIASAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEEAIQFINQR
EKPLALYIFSSNDKVIKKMIAETSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKS
FETFSHRRSCLVRPLMNDEGLKVRYPPSPAKMTQH
Download sequence
Identical sequences ENSGGOP00000024007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]