SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024129 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024129
Domain Number 1 Region: 153-266
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000306
Family V set domains (antibody variable domain-like) 0.01
Further Details:      
 
Domain Number 2 Region: 291-401
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000161
Family V set domains (antibody variable domain-like) 0.034
Further Details:      
 
Domain Number 3 Region: 28-124
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000781
Family I set domains 0.075
Further Details:      
 
Domain Number 4 Region: 430-467,498-561
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000725
Family C1 set domains (antibody constant domain-like) 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024129   Gene: ENSGGOG00000022319   Transcript: ENSGGOT00000025687
Sequence length 665
Comment pep:novel chromosome:gorGor3.1:1:119661756:119753611:-1 gene:ENSGGOG00000022319 transcript:ENSGGOT00000025687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCFFPVLSCLAVLESSISVEVASNASVILEGKDLRFSCSVRMAGRLQGRFSVIWQLVDR
QNRRSNIMWLDRDGTVQPGSSYWERSSFGSVQMEQVQPNSFSLGIFNSRKEDKGQYECHV
TEWVRVVDGEWQIVGERRASTPISIIALVTKLQVSKSKRTLTLVENKPIQLNCSVKSQTS
QNSHFAVLWYVHKPSDADGKLILKTTHNSAFEYGTYAEEEGLRARLQFERHVSGGLFSLT
VQRAEVSDSGSYYCHVEEWLLSPNYAWYKLAEEVSGRTEVTVKQPDSRLRLSQAQGNLSV
LETRQVQLECVVLNRTSITSQLMVEWFVWKPNHPERETVARLSRDATFHYGEQAAKNNLK
GRLHLESPSPGVYRLFIQNVAVQDSGTYSCHVEEWLPSPSGMWYKRAEDTAGQTALTVMR
PDASLQVDTVVPNATVSEKAAFQLDCSIVSRSSQDSRFAVAWYSLRTKAGGKRSSPGLEE
QEEEREEEEEEDDNDDDPTERTALLSVGPDAVFGPEGSPWEGRLRFQRLSPVLYRLTVLQ
ASPRDTGNYSCHVEEWLPSPQKEWYRLTEEESAPIGIRVLDTSPTLQSIICSNDALFYFV
FFYPFPIFGILIITILLVRFKSRNSSKNSDGKNGVPLLWIKEPHLNYSPTCLEPPVLSIH
PGAID
Download sequence
Identical sequences G3S7R9
ENSGGOP00000024129 ENSGGOP00000024129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]