SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024211 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024211
Domain Number 1 Region: 932-1014
Classification Level Classification E-value
Superfamily Immunoglobulin 1.16e-20
Family I set domains 0.017
Further Details:      
 
Domain Number 2 Region: 1018-1105
Classification Level Classification E-value
Superfamily Immunoglobulin 3.21e-18
Family I set domains 0.043
Further Details:      
 
Domain Number 3 Region: 628-689
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000227
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0026
Further Details:      
 
Domain Number 4 Region: 798-878
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000443
Family I set domains 0.014
Further Details:      
 
Domain Number 5 Region: 188-241
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000262
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 6 Region: 247-305
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000262
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 7 Region: 367-419
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000262
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 8 Region: 304-361
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000034
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024211   Gene: ENSGGOG00000002134   Transcript: ENSGGOT00000026016
Sequence length 1161
Comment pep:known_by_projection chromosome:gorGor3.1:14:54458471:54517107:1 gene:ENSGGOG00000002134 transcript:ENSGGOT00000026016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNKCELNCIPKGENFYYKHREAVVDGTPCEPGKRDVCVDGSCRVVGCDHELDSSKQEDKC
LRCGGDGTTCYPVAGTFDANDLSRGYNQILIVPVGATSILIEEAAASRNFLAVKNVRGEY
YLNGHWTIEAARALPAASTILHYERGAEGDLAPERLHARGPTSEPLVIELISQEPNPGVH
YEYHLPLSWSHGSWSDCSAECGGGHQSRLVFCTIDHEAYPDHMCQRQPRPADRRSCNLHP
CPETKRWKAGPWAPCSASCGGGSQSRSVYCISSDGAGIQEAVEEAECAGLPGKPPAIQAC
NLQRCAAWSPEPWGECSVSCGTGIRKRSVTCRGERGSLLHTAACSLEDRPPLTEPCVHED
CPLLSDQAWHVGTWGLCSKSCSSGTRRRQVICAIGPPSHCGSLQHSKPVDVEPCNTQPCH
LPQEVPSMQDVHTPASNPWMPLGPQESPASDSRGQWWAAQEHPSARGDHRGERGDPRGDQ
GTHLSALGPAPSLQQPPYQQPLRSGSGPHDCRHSPHGCCPDGHTASLGPQWQGCPGAPCQ
QSRYGCCPDRVSVAEGPHHAGCTKSYGGDSTGGRPRSRAVASTVHNTHQPHAQQNEPSEC
RGSQFGCCYDNVATAAGPLGEGCVGQPSHAYPVRCLLPSAHGSCADWAARWYFVASVGQC
NRFCFWYGGCHGNANNFASEQECMSSCQGSLHGPRRPQPGASGRSTHTDGGGSSPAGKQE
PSQHRTGAAVQRKPWPSGGLWRQDQQPGPGEAPHTQAFGEWPWGQELGSRAPGLGGDAGS
PAPPFHSSSYRISLAGMKPSLVQAALGQLVWLSCSDDTAPESQAAWQKDGQPISSDRHRL
QSDGSLIIHPLQAEDAGTYSCGSTRPGRDSQKIQLRIIGGDMAVLSEAELSRFPQPRDPA
QDFGQAGAAGPLGAIPSSHPQPANRLRLDQNQPRVVDASPGQRIRMTCRAEGFPPPAIEW
QRDGQPVSSPRHQLQPDGSLVISRVAVEDGGFYTCVAFNGQDQDQRWVQLRVLGELTISG
LLPTVTVPEGDTARLLCVVAGESVNIRWSRNGLPVQADGHRVHQSPDGTLLIYNLRARDE
GSYTCSAYQGSQAVSRSTEVKVVSPAPTAQPRDPGRDCIDQPELANCDLILQAQLCGNEY
YSSFCCASCSRFQPHAQPIWQ
Download sequence
Identical sequences ENSGGOP00000024211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]