SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024279 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024279
Domain Number 1 Region: 184-320,385-451,491-658
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.28e-45
Family Quinoprotein alcohol dehydrogenase-like 0.027
Further Details:      
 
Domain Number 2 Region: 623-766
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000266
Family WD40-repeat 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024279   Gene: ENSGGOG00000015482   Transcript: ENSGGOT00000031136
Sequence length 768
Comment pep:known_by_projection chromosome:gorGor3.1:19:42830987:42863318:-1 gene:ENSGGOG00000015482 transcript:ENSGGOT00000031136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EECADGLESCXQRLQLQEDELAVLKAALADALRRLRACEEQGAALRARGTPKGRAPPRTP
LNGSGPPRRVGGYATSPSSPKKEATSGRSSVRRYLSPERLASVRREDPRSRTTSSSSNCS
AKKEGKTKEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLDWYVY
GYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIA
TGQVAGTTEKSAPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDE
SNDHMLSVWDWAKETKVVDVKCGTCPISVANFHPTDPTVLITCGKSHIYFWTLEGGSLSK
RQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGLC
ALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSIL
QGSAHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIEDPA
RSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQISVVSFSPDGAYLAVGSHD
NLVYVYTVDQGGRKVSRLGKCSGHSSFITHLDWAQDSSCFVTNSGDYEILYWDPATCKQI
TSADAVRNMEWATATCVLGFGVFGIWSEGADGTDINAVARSHDGKLLASADDFGKVHLFS
YPCCQPRALSHKYGGHSSHVTNVAFLWDDSMALTTGGKDTSVLQWRVV
Download sequence
Identical sequences ENSGGOP00000024279 ENSGGOP00000015107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]