SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024373 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024373
Domain Number 1 Region: 309-402
Classification Level Classification E-value
Superfamily Immunoglobulin 4.32e-24
Family I set domains 0.0089
Further Details:      
 
Domain Number 2 Region: 407-502
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-23
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 175-270
Classification Level Classification E-value
Superfamily Immunoglobulin 5.29e-22
Family I set domains 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024373   Gene: ENSGGOG00000009674   Transcript: ENSGGOT00000032522
Sequence length 506
Comment pep:known_by_projection chromosome:gorGor3.1:4:179001617:179439283:1 gene:ENSGGOG00000009674 transcript:ENSGGOT00000032522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFNAAERETNGVHPSRGVNGLINGKANSNKSLPTPAVLLSPTKEPPPLLAKPKLGFPKK
ASRTARIASDEEIQGTKDAVIQDLERKLRFKEDLLNNGQPRLTYEERMARRLLGADSATV
FNIQEPEEETANQEYKVSSCEQRLISEIEYRLERSPVDESGDEVQYGDVPVENGMAPFFE
MKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTTA
STLDDDGNYTIMAANPQGRISCTGRLMVQAVNQRGRSPRSPSGHPHGRRPRSRSRDSGDE
NEPIQERFFRPHFLQAPGDLTVQEGKLCRMDCKVSGLPTPDLSWQLDGKPVRPDSAHKML
VRENGVHSLIIEPVTSRDAGIYTCIATNRAGQNSFSLELVVAAKEAHKPPVFIEKLQNTG
VADGYPVRLECRVLGVPPPQIFWKKENESLTHSTDRVSMHQDNHGYICLLIQGATKEDAG
WYTVSAKNEAGIVSCTARLDVYISRH
Download sequence
Identical sequences ENSGGOP00000024373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]