SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024396 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024396
Domain Number 1 Region: 43-134
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-21
Family V set domains (antibody variable domain-like) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024396   Gene: ENSGGOG00000025048   Transcript: ENSGGOT00000030243
Sequence length 134
Comment pep:known_by_projection chromosome:gorGor3.1:7:141015545:141016046:1 gene:ENSGGOG00000025048 transcript:ENSGGOT00000030243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAPAHSDPDLAKLPSCPDPAMGTRLLCWVAFCLLGEGLIEAGVVQSPRYKIIEKKQPVAF
WCNPISGHNTLYWYRQNLGQGPELLIRYENEEAVDDSQLPKDRFSAERLKGVDSTLKIQP
AELGDSAVYLCASS
Download sequence
Identical sequences ENSGGOP00000024396 ENSGGOP00000024396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]