SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024414 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024414
Domain Number 1 Region: 508-699
Classification Level Classification E-value
Superfamily Fibronectin type III 7.78e-25
Family Fibronectin type III 0.00000322
Further Details:      
 
Domain Number 2 Region: 203-307
Classification Level Classification E-value
Superfamily Immunoglobulin 8.89e-24
Family I set domains 0.0000181
Further Details:      
 
Domain Number 3 Region: 300-412
Classification Level Classification E-value
Superfamily Immunoglobulin 2.76e-20
Family I set domains 0.011
Further Details:      
 
Domain Number 4 Region: 411-511
Classification Level Classification E-value
Superfamily Immunoglobulin 1.19e-19
Family I set domains 0.0097
Further Details:      
 
Domain Number 5 Region: 118-213
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000224
Family I set domains 0.0000118
Further Details:      
 
Domain Number 6 Region: 21-112
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000271
Family I set domains 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024414   Gene: ENSGGOG00000013097   Transcript: ENSGGOT00000033848
Sequence length 857
Comment pep:known_by_projection chromosome:gorGor3.1:11:111026613:111106049:1 gene:ENSGGOG00000013097 transcript:ENSGGOT00000033848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFEWKIWVSFLKIGISVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEK
LTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFK
NAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKK
TDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFP
EPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATIH
LKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEK
QETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGP
VAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSE
NDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPIL
KYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAAS
EFKTQPVREPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRAKLSSEWKPEIR
LPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSPTSGLST
GAIVGILIVIFVLLLVVVDITCYFLNKCGLFMCIAVNLCGKAGPGAKGKDMEEGKAAFSK
DESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAEV
KTVPNDATQTKENESKA
Download sequence
Identical sequences ENSGGOP00000024414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]