SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024470 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024470
Domain Number 1 Region: 45-106
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.71e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024470   Gene: ENSGGOG00000006147   Transcript: ENSGGOT00000022200
Sequence length 163
Comment pep:known_by_projection chromosome:gorGor3.1:4:184141249:184143177:-1 gene:ENSGGOG00000006147 transcript:ENSGGOT00000022200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HEENPYFHGWLIGHPEMSPPDYSMALSYSPEYASGAAGLDHSHLKRRGTANRKERRRTQS
INSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKT
DVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ
Download sequence
Identical sequences ENSGGOP00000024470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]