SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024570 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024570
Domain Number 1 Region: 53-147
Classification Level Classification E-value
Superfamily Immunoglobulin 1.65e-16
Family V set domains (antibody variable domain-like) 0.0051
Further Details:      
 
Domain Number 2 Region: 168-242
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000127
Family I set domains 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024570   Gene: ENSGGOG00000025814   Transcript: ENSGGOT00000030985
Sequence length 247
Comment pep:known_by_projection chromosome:gorGor3.1:1:120255936:120273072:-1 gene:ENSGGOG00000025814 transcript:ENSGGOT00000030985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKRNGEVIFCFSVSSHSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGIL
SCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDELFRGRTAVFADQVIVGNAS
LRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWF
PQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKA
TGDIKVT
Download sequence
Identical sequences ENSGGOP00000024570 ENSGGOP00000024570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]