SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024580 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024580
Domain Number 1 Region: 88-250
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-19
Family C-type lectin domain 0.0069
Further Details:      
 
Domain Number 2 Region: 11-51
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000038
Family LDL receptor-like module 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000024580
Domain Number - Region: 249-314
Classification Level Classification E-value
Superfamily FnI-like domain 0.0009
Family VWC domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024580   Gene: ENSGGOG00000028492   Transcript: ENSGGOT00000032108
Sequence length 534
Comment pep:known_by_projection chromosome:gorGor3.1:22:2567718:2621538:-1 gene:ENSGGOG00000028492 transcript:ENSGGOT00000032108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNGLSPFGPTELRCNPGQFACRSGTIQCIPLPWQCDGWATCEDESDEANCPEVTGEARPH
HGKEAVDPRQGRARGGDPTHFHAVNVAQPVRFSSFLGKCPTGWHHYEGTASCYRVYLSGE
NYWDAAQTCQRLNGSLATFSTDQELRFVLAQEWDQPERSFGWKDQRKLWVGYQYVITGRN
HSLEGRWEVAFKGSSEVFLPPDPIFASAMSENDNVFCAQLQCFHFPTLRHHDLHSWHAES
CYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHGGEPEMCVAALCERPQG
CQQYRKDPKECCKFMCLDPDGNSLFDSMASGMRLVVSCISSFLILSLLLFMVHRLRQRRR
ERIESLIGANLHHFNLGRRIPGFDYGPDGFGTGLTPLHLSDDGEGGTFHFHDPPPPYTAY
KYPDIGQPDDPPPPYEASIHPDSVFYDPADDDAFEPAEVSLPAPGDGGSEGALPRRLEQP
LPTAGASLADLEDSADSSSALLVPPDPAQSGSTPATEALPGGGRHSRSSLNTVV
Download sequence
Identical sequences ENSGGOP00000024580 ENSGGOP00000024580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]