SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024621 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024621
Domain Number 1 Region: 28-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000263
Family V set domains (antibody variable domain-like) 0.055
Further Details:      
 
Domain Number 2 Region: 128-205
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000286
Family I set domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024621   Gene: ENSGGOG00000003643   Transcript: ENSGGOT00000027397
Sequence length 240
Comment pep:known_by_projection chromosome:gorGor3.1:1:139748312:139754819:-1 gene:ENSGGOG00000003643 transcript:ENSGGOT00000027397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TCSTSPGYTLGLSATLPSLGISLAGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFD
QKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKI
KLQVLDPVPKPVIKIEKVEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLET
TLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGLLLT
Download sequence
Identical sequences ENSGGOP00000024621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]