SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024701 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024701
Domain Number 1 Region: 112-397
Classification Level Classification E-value
Superfamily L domain-like 2.47e-46
Family Internalin LRR domain 0.034
Further Details:      
 
Domain Number 2 Region: 414-717
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.74e-41
Family Rhodopsin-like 0.00063
Further Details:      
 
Domain Number 3 Region: 41-80
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000127
Family LDL receptor-like module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024701   Gene: ENSGGOG00000002645   Transcript: ENSGGOT00000027748
Sequence length 757
Comment pep:known_by_projection chromosome:gorGor3.1:13:13594479:13657909:1 gene:ENSGGOG00000002645 transcript:ENSGGOT00000027748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIIFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQGSMITPSCQKGYFPCGNLTKCLP
RAFHCDGKDDCGNGADEENCGDSSGWATIFGTVHGNANSVALTQECFLKQYPQCCDCKET
ELECVNGDLKSVPMISNNVTLLLPIQGEKNGLHTVSDKVFIKYTKLKKIFLQHNCIRHIS
RKAFFGLYNLQILYLNHNCITTLRPGIFKDLHQLTWLILDDNPITRISQRLFTGLNSLFF
LSMVNNYLEALPKQMCAQMPQLNWVDLEGNRIKYLTNSTFLSCDLLTVLFLPRNQIGFVP
EKTFSSLKNLGELDLSSNMITELSPHLFKDLKLLQKLNLSSNPLMYLHKNQFESLKQLQS
LDLERIEIPNINTRMFQPMKNLSHIYFKNFRYCSYAPHVRICMPLTDGISSLEDLLANNI
LRIFVWVIAFITCFGNLFVIGMRSFIKAENTTHAMSIKILCCADCLMGVYLFFVGFFDIK
YRGQYQKYALLWMESVQCRLMGFLAMLSTEVSVLLLTYLTLEKFLVIVFPFSNIRPGKRQ
TSVILICIWMVGFLIAVIPFWNKDYFGNFYGKNGVCFPLYYDQTEDIGSKGYSLGIFLGV
NLLAFLIIVFSYITMFCSIQKTALQTTEVRNCFGREVAVANRFFFIVFSDAICWIPVFVV
KILSLFRVEIPDTMTSWIVIFFLPVNSALNPILYTLTTNFFKDKLKQLLHKHQRKSIFKI
KKKSLSTSIVWIEDSSSLKLGVLNKITLGDSIMKPVS
Download sequence
Identical sequences ENSGGOP00000002611 ENSGGOP00000024701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]