SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024726 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024726
Domain Number 1 Region: 41-110
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000327
Family BphP N-terminal domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024726   Gene: ENSGGOG00000005844   Transcript: ENSGGOT00000023284
Sequence length 774
Comment pep:known_by_projection chromosome:gorGor3.1:X:149439184:149554772:1 gene:ENSGGOG00000005844 transcript:ENSGGOT00000023284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGKKRRDKVNPKSSQRKLNWIPSFRTYDYFNQVTLQLLDGFMITLSTDGVIVYVAENIS
SLLGHLPAEIVGKKLLSLLPDEEKDEVYQKIILKFPLLNSETHIEFCCHLKRGNVEHGDS
SAYENVKFIVNVRDICNEFPVVFSDLFSNHLCADFAACIPQEDRFYLVGNVCILRTQLLQ
QLCTSKAVSDEAVLTQDSDEEPFVGELSSSQGQRGHTSMKVVYVEPAAAAAAAAAAEDQI
DVAEVEQYGPQENVHMFVDSDSTYCSSTVFLDTMPESPALPLQDFRGEPEVNPLYMADPV
DLEFSVDQMDSVDQEGPMDQQDPENPVALLDQAGLMDLVDPEDSVDLGAAGASAQPLQPS
SPVAYDIISQELELMKKLKEQLEERTWLLHDAIQNQQNALELMMDQLQKQPNTLRHIVIP
DLQSSEAVPKKQQKQHAGQVKRPLPHPKEVKCFCGLSLSNSLKNTGELQEPCVAFNQQQL
VQQEKHLKEQQRQLREQQRQLREQLQQLREQRKVQKQKKMQEKKKLQEQRQQKKKKLQER
KKWQGQMLQKEPEEEQQKQQLQEQPLKRNVIMGNERVQICLQNPSDVSVPLCNNPVRFLQ
TQPIVPIQGVAEQQPSGFYQDENCGQQEDESQSFYPEAYQGPPMNQLPLIDTSNSEAISS
SSIPQFPITSDSTISTLETPQDYIQLWQELSDSLGPVVQVNTWSCDEQGTLHGQPTYHQV
QVSEVGVEGPPDPQAFQGPAAYQPDQMRSAEQTRLMPAEQRDSNKPCQQYFRDQ
Download sequence
Identical sequences ENSGGOP00000005729 ENSGGOP00000024726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]