SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024747 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024747
Domain Number 1 Region: 1214-1406,1473-1618
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.01e-64
Family YicI catalytic domain-like 0.00075
Further Details:      
 
Domain Number 2 Region: 338-482,553-717
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.31e-60
Family YicI catalytic domain-like 0.0031
Further Details:      
 
Domain Number 3 Region: 94-337
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.07e-50
Family YicI N-terminal domain-like 0.0057
Further Details:      
 
Domain Number 4 Region: 963-1210
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 6.91e-45
Family YicI N-terminal domain-like 0.0084
Further Details:      
 
Domain Number 5 Region: 1621-1701
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.15e-16
Family Putative glucosidase YicI, domain 3 0.024
Further Details:      
 
Domain Number 6 Region: 720-800
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000000000115
Family Putative glucosidase YicI, domain 3 0.02
Further Details:      
 
Domain Number 7 Region: 935-987
Classification Level Classification E-value
Superfamily Trefoil 0.000000000575
Family Trefoil 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024747   Gene: ENSGGOG00000027385   Transcript: ENSGGOT00000031023
Sequence length 1841
Comment pep:known_by_projection chromosome:gorGor3.1:3:165780433:165875467:-1 gene:ENSGGOG00000027385 transcript:ENSGGOT00000031023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKKFSGLEISLIVLFVIVTIIAIALIVVLATKTPAVDEFFPPPEISDSTSTPATTRVT
TNPSDSGKCPNVLNDPVNVRINCIPEQFPTEGICAQRGCCWRPWNDSLIPWCFFVDNHGY
NVQDMTTTSIGVEAKLNRIPSPTLFGNDINSVLFTTQNQTPNRFRFKITDPNNRRYEVPH
QYVKEFTGPTVSDTLYDVKVAQNPFSIQVTRKSNGKTLFDTSIGPLVYSDQYLQISTRLP
SDYIYGIGEQVHKRFRHDLSWKTWPIFTRDQLPGDNNNNLYGHQTFFMCIEDTSGKSFGV
FLMNSNAMEIFIQPTPIVTYRVTGGILDFYILLGDTPEQVVQQYQQLVGLPAMPAYWNLG
FQLSRWNYKSLDVVKEVVRRNREAGIPFDTQVTDIDYMEDKKDFTYDQVAFNGLPQFVQD
LHDHGQKYVIILDPAISIGQRANGTTYATYERGNTQHVWINESDGSTPIIGEEVMQNVKI
YHKFSLPNVIIVSNKSNNFNYSTSYSCLFIQINIKAYTFGNKLICFILLYVLNYPTMTTW
IWTKAMISKVLVMPLKKHYNSIFQNQMLSGYQMPMFIFRAVQKVFPNKRSFILTRSTFAG
SGRHAAHWLGDNTASWEQMEWSITGMLEFSLFGIPLVGADICGFVAETTEELCRRWMQLG
AFYPFSRNHNSDGYEHQDPAFFGQNSLLVKSSRQYLTIRYTLLPFLYTLFYKAHVFGETV
ARPVLHEFYEDTNSWTEDTEFLWGPALLITPVLKQGADTVSAYIPDAIWYDYESGAKRPW
RKQRVDMYLPADKIGLHLRGGYIIPIQEPDVTTTASRKNPLGLIVALGENNTAKGDFFWD
DGETKDTIQNGNYILYTFSVSNNTLDIVCTHSSYQEGTTLAFQTVKILGLTDSVTEVRVA
ENNQPMSAHSNFTYDASNQKVLLIADLKLNLGRNFSVQWNQIFSENERFNCYPDADLATE
QKCTQRGCIWRTGSSLSKAPECYFPRQDNSYSVNSARYSSMGITADLQLNTANARIKLPS
DPISTLRVEVKYHKNDMLQFKIYDPQKKRYEVPVPLNIPTTPISTYEDRLYDVEIKENPF
GIQIRRRSSGRVIWDSGLPGFAFNDQFIQISTRLPSEYIYGFGEVEHTAFKRDLNWNTWG
MFTRDQPPGYKLNSYGFHPYYMALEEEGNAHGVFLLNSNAMDVTFQPTPALTYRTVGGIL
DFYMFLGPTPEVATKQYHEVIGHPVMPAYWALGFQLCRYGYANTSEVRELYDAMVAANIP
YDVQYTDIDYMERQLDFTIGEAFQDLPQFVDKIRGEGMRYIIILDPAISGNETKTYPAFE
RGQQNDVFVKWPNTNDICWAKVWPDLPNITIDKTLTEDEAVNASRAHAAFPDFFRTSTAE
WWAREIVDFYNEKMKFDGLWIVSNNKHTTKISLSYKETTLCRILINLTKLILFANELNSK
NTFSYRFIELSPIITLHVIKFILQRLRREINHMISFTQPILISALQKTTGKRGIVISRST
YPTSGRWGGHWLGDNYARWDNMDKSIIGMMEFSLFGISYTGADICGFFNNSEYHLCTRWM
QLGAFYPYSRNHNIANTRRQDPASWNETFAEMSRNILNIRYTLLPYFYTQMHEIHANGGT
VIRPLLHEFFDEKPTWDIFKQFLWGPAFMVTPVLEPYVQTVNAYVPNARWFDYHTGKDIG
VREQFQTFNASYDTINLHVRGGHILPCQEPAQNTFYSRQKHMKLIVAADDNQMAQGSLFW
DDGESIDTYERDLYLSVQFNLNQTTLTSTILKRGYINKSETRLGSIQVWGKGTNPVNAVT
LTYNGNKNSLPFNEDSTNMILHIDLTTHNVTLEEPIEINWS
Download sequence
Identical sequences ENSGGOP00000024747 ENSGGOP00000024747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]