SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024756 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024756
Domain Number 1 Region: 46-156
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.05e-38
Family Frizzled cysteine-rich domain 0.0000587
Further Details:      
 
Domain Number 2 Region: 173-301
Classification Level Classification E-value
Superfamily TIMP-like 3.92e-23
Family Tissue inhibitor of metalloproteinases, TIMP 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024756   Gene: ENSGGOG00000012574   Transcript: ENSGGOT00000030419
Sequence length 311
Comment pep:known_by_projection chromosome:gorGor3.1:10:111138276:111144589:-1 gene:ENSGGOG00000012574 transcript:ENSGGOT00000030419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRIQASWLLALLLGALHWAPARCEEYDYYGWQAEPLHGRSYSKPPQCLDIPADLPLCHTV
GYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIYPCRS
LCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKICAQCEM
EHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKPGPLKRKDTKRLVLH
MKNGAGCPCPQLDSLAGSFLVMGRKVDGQLLLMAIYRWDKKNKEMKFAVKFMFSYPCSLY
YPFFYGAAEPH
Download sequence
Identical sequences ENSGGOP00000024756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]