SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024761 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024761
Domain Number 1 Region: 114-158
Classification Level Classification E-value
Superfamily LysM domain 0.0000000235
Family LysM domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024761   Gene: ENSGGOG00000016074   Transcript: ENSGGOT00000030761
Sequence length 942
Comment pep:known_by_projection chromosome:gorGor3.1:6:126233870:126380628:1 gene:ENSGGOG00000016074 transcript:ENSGGOT00000030761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKEEKKERKQSYFARLKKKKQAKQNAETASAIAARTHTGKEDANTVVLEPDKCNIAVE
EEYMTDEKKKRKSNQLKEIRRTELKRYYSIDDNQNKTHDKKEKKMVVQKPHGTMEYTAGN
QDTLNSIALKFNITPNKLVELNKLFTHTIVPGQVLFVPDANSPSGTLRLSSSSPGATVSP
SSSDAEYDKLPDADLARKALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGKGVVGGVM
IVTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIALYNDISHMKIKDALPSDLPQD
LCPLYRPGEWEDLASEKDINPFSKFKSINKEKRQQNGEKIMTSDSRPTVPLEKSTEHTPT
KPSGSSVSEKLKKLESSRETSHGSPTVTKLSKEPSDTSAAFESTAKENFLGEDDDFVDLE
ELSSQTGDGMDKKDTSKECLSLDPEERKKAESQINNSAVEMQVQSALAFLGTENDAELKG
ALDLETCEKQDIMPEVDKQSGSPESRVENTLNIHEDLDKVKLIEYYLNKNKEGPQVSENL
QKTELSDGKSIEPGGIDITLSSSLSQSGDPITEGNKEPDKTWVKKGEPLPVKLNSSTEAN
VIKEALDSSLESTLDNSCQGAQMDNKSEVQLWLLKRIQVPIEDILPSKEEKSKTPPMFLC
IKVGKPMRKSFATHTAAMVQQYGKRRKQPEYWFAVPRERVDHLYTFFVQWSPDVYGKDAK
EQGFVVVEKEELNMIDNFFSEPTTKSWEIITVEEAKRRKSTCSYYEDEDEEVLPVLRPHS
ALLENMHIEQLARRLPARVQGYPWRLAYSTLEHGTSLKTLYRKSASLDSPVLLVIKDMDN
QIFGAYATHPFKFSDHYYGTGETFLYTFSPHFKVFKWSGENSYFINGDISSLELGGGGGR
FGLWLDADLYHGRSNSCSTFNNDILSKKEDFIVQDLEVWAFE
Download sequence
Identical sequences G3S9J5
ENSGGOP00000015683 XP_004044686.1.27298 XP_018885509.1.27298 XP_018885510.1.27298 ENSGGOP00000024761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]