SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024845 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024845
Domain Number 1 Region: 947-1150
Classification Level Classification E-value
Superfamily Fibronectin type III 7.54e-42
Family Fibronectin type III 0.00000151
Further Details:      
 
Domain Number 2 Region: 1148-1348
Classification Level Classification E-value
Superfamily Fibronectin type III 1.62e-39
Family Fibronectin type III 0.00098
Further Details:      
 
Domain Number 3 Region: 1443-1622
Classification Level Classification E-value
Superfamily Fibronectin type III 9.79e-31
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 4 Region: 286-374
Classification Level Classification E-value
Superfamily Immunoglobulin 1.25e-23
Family I set domains 0.014
Further Details:      
 
Domain Number 5 Region: 743-846
Classification Level Classification E-value
Superfamily Immunoglobulin 2.38e-20
Family I set domains 0.022
Further Details:      
 
Domain Number 6 Region: 653-753
Classification Level Classification E-value
Superfamily Immunoglobulin 4.89e-20
Family I set domains 0.022
Further Details:      
 
Domain Number 7 Region: 1349-1448
Classification Level Classification E-value
Superfamily Immunoglobulin 3.76e-19
Family I set domains 0.014
Further Details:      
 
Domain Number 8 Region: 468-568
Classification Level Classification E-value
Superfamily Immunoglobulin 1.06e-18
Family I set domains 0.0096
Further Details:      
 
Domain Number 9 Region: 369-456
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000337
Family I set domains 0.028
Further Details:      
 
Domain Number 10 Region: 569-659
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000725
Family I set domains 0.052
Further Details:      
 
Domain Number 11 Region: 848-951
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000477
Family I set domains 0.04
Further Details:      
 
Domain Number 12 Region: 92-180
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000229
Family I set domains 0.024
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000024845
Domain Number - Region: 188-281
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000293
Family V set domains (antibody variable domain-like) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024845   Gene: ENSGGOG00000006455   Transcript: ENSGGOT00000031877
Sequence length 2113
Comment pep:known_by_projection chromosome:gorGor3.1:11:115346221:115726783:-1 gene:ENSGGOG00000006455 transcript:ENSGGOT00000031877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGAGEPRREEPPPQPSAGLRSRESGARSAGGWERAERGRGAAARPATGPPPRRIGPLYG
MWLVTFLLLLDSLHKARPEDVGTSLYFVNDSLQQVTFSSSVGVVVPCPAAGSPSAALRWY
LATGDDIYDVPHIRHVHANGTLQLYPFSPSAFNSFIHDNDYFCTAENAAGKIRSPNIRVK
AVFREPYTVRVEDQRSMRGNVAVFNCLIPSTLTAGINTPNLQNYVLIVSPENRFFITYHG
GLYISDVQKEDALSTYRCITKHKYSGETRQSNGARLSVTDPAESIPTILDGFHSQEVWAG
HTVELPCTASGYPIPAIRWLKDGRPLPADSRWTKRITGLTISDLRTEDSGTYICEVTNTF
GSAEATGILMVIDPLHVTLTPKKLKTGIGSTVILSCALTGSPEFTIRWYRNTELVLPDEA
ISIRGLSNETLLITSAQKSHSGAYQCFATRKAQTAQDFAIIALEDGTPRIVSSFSEKVVN
PGEQFSLMCAAKGAPPPTVTWALDDEPIMRDGSHRTNQYTMSDGTTISHMNVTGPQIRDG
GVYRCTARNLVGSAEYQARINVRGPPSIRAMRNITAVAGRDTLINCRVIGYPYYSIKWYK
DALLLPDNHRQVVFENGTLKLTDVQKGMDEGEYLCSVLIQPQLSISQSVHVAVKVPPLIQ
PFEFPPASIGQLLYIPCVVSSGDMPIRITWRKDGQVIISGSGVTIESKEFMSSLQISSVS
LKHNGNYTCIASNAAATVSRERQLIVRVPPRFVVQPNNQDGIYGKAGVLNCSVDGYPPPK
VMWKHAKGSGNPQQYHPVPLTGRIQILPNSSLLIRHVLEEDIGYYLCQASNGVGTDISKS
MFLTVKIPAMITSHPNTTIAIKGHAKELNCMARGERPIIIRWEKGDTVIDPDRVMRYAIA
TKDNGDEVVSTLKLKPADRGDSVFFSCHAINSYGEDRGLIQLTVQEPPDPPELEIREVKA
RSMNLRWTQRFDGNSIITGFDIEYKNKSDSWDFKQSTRNISPTINQANIVDLHPASVYSI
RMYSFNKIGRSEPSKELTISTEEAAPDGPPMDVTLQPVTSQSIQVTWKAPKKELQNGVIR
GYQIGYRENSPGSNGQYSIVEMKATGDSEVYTLDNLKKFAQYGVVVQAFNRAGTGPSSSE
INATTLEDVPSQPPENVRALSITSDVAVISWSEPPRSTLNGVLKGYRVIFWSLYVDGEWG
EMQNITTTRERVELRGMEKFTNYSVQVLAYTQAGDGVRSSVLYIQTKEDVPGPPAGIKAV
PSSASSVVVSWLPPTKPNGVIRKYTIFCSSPGSGQPAPSEYETSPEQLFYRIAHLNRGQQ
YLLWVAAVTSAGRGNSSEKVTIEPAGKAPAKIISFGGTVTTPWMKDVRLPCNSVGDPAPA
VKWTKDSEDSAIPVSMDGHRLIHTNGTLLLRAVKAEDSGYYTCTATNTGGFDTIIVNLLV
QVPPDQPRLTVSKTSASSITLTWIPGDNGGSSIRGFVLQYSVDNSEEWKDVFISSSERSF
KLDSLKCGTWYKVKLAAKNSVGSGRISEIIEAKTHGREPSFSKDQHLFTHINSTHARLNL
QGWNNGGCPITAIVLEYRPKGTWAWQGLRANSSGEVFLTELREATWYELRMRACNSAGCG
NETAQFATLDYDGSTIPPIKSAQGEGDDVKKLFTIGCPVILATLGVALLFIVRKKRKEKR
LKRLRDAKSLAEMLISKNNRSFDTPVKGPPQGPRLHIDIPRVQLLIEDKEGIKQLGDDKA
TIPVTDAEFSQAVNPQSFCTGVSLHRPALIQSTGPLIDMSDIRPGTNPVSRKNVKSAHST
RNRYSSQWTLTKCQASTPARTLTSDWRTVGSQHGVTVTESDSYSASLSQDTDKGRNSMVS
TESASSTYEELARAYEHAKLEEQLQHAKFEITECFISDSSSDQMTTGTNENADSMTSMST
PSEPGICRFTASPPKPQDADRGKNVAVPIPHRANKSDYCNLPLYAKSEAFFRKADGREPC
PVVPPREASIRNLARTYHTQARHLTLDPASKPLGLPHPGTPAAASTATLPQRTLAMPAPP
AGTAPPAPGPTPAEPPTAPSAAPPAPSTEPPRAGGPHTKMGGSRDSLLEMSTSGVGRSQK
QGAGAYSKSYTLV
Download sequence
Identical sequences ENSGGOP00000006322 ENSGGOP00000024845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]