SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024869 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024869
Domain Number 1 Region: 20-120
Classification Level Classification E-value
Superfamily Immunoglobulin 1.95e-51
Family V set domains (antibody variable domain-like) 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024869   Gene: ENSGGOG00000026890   Transcript: ENSGGOT00000027781
Sequence length 122
Comment pep:novel chromosome:gorGor3.1:14:88806254:88806720:-1 gene:ENSGGOG00000026890 transcript:ENSGGOT00000027781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFGLSWVFLVAILRGVQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYHMSWVRQAP
GKGLEWVSVIYSDGSSTYYAASVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDTV
RG
Download sequence
Identical sequences ENSGGOP00000024869 ENSGGOP00000024869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]