SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024902 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024902
Domain Number 1 Region: 30-125
Classification Level Classification E-value
Superfamily Immunoglobulin 6.41e-26
Family V set domains (antibody variable domain-like) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024902   Gene: ENSGGOG00000025182   Transcript: ENSGGOT00000027912
Sequence length 132
Comment pep:known_by_projection chromosome:gorGor3.1:22:6170539:6171074:1 gene:ENSGGOG00000025182 transcript:ENSGGOT00000027912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTQHCNSSTMAWAPLLLTLLSLLTGSLSQPVLTQPPSASASLGASVTLTCPLSSGYSNYK
VDWYQQRPGKGPRFVMRVGTSGIVGSKGDGIPDRFSVLGSGLNRYLTIKNIQEEDESDYH
CGAEHGSGSNFV
Download sequence
Identical sequences ENSGGOP00000024902 ENSGGOP00000024902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]