SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024948 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024948
Domain Number 1 Region: 281-455,502-577
Classification Level Classification E-value
Superfamily Kelch motif 6.15e-38
Family Kelch motif 0.002
Further Details:      
 
Domain Number 2 Region: 6-126
Classification Level Classification E-value
Superfamily POZ domain 7.33e-25
Family BTB/POZ domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024948   Gene: ENSGGOG00000027920   Transcript: ENSGGOT00000023324
Sequence length 588
Comment pep:novel chromosome:gorGor3.1:9:36912007:36913915:1 gene:ENSGGOG00000027920 transcript:ENSGGOT00000023324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLEFTEKNYNSFVLQNLNRQRKRKEYWDMALSVDHHVFFAHRNVLAAVSPLVRSLISSN
DMKTADELFITIDTSYLSPVTVDQLLDYFYSGKVVISEQNVEELLRGAQYFNTPRLRVHC
NDFLIKSICRANCLRYLFLAELFELKEVSDVAYSGIRDNFHYWASPEGSMHFMRCPPVIF
GRLLRDENLHVLNEDQALSVLINWVYFRKEDREKYFKKFFSYINLNAVSNKTLVFASNKL
VGMENTSSHTTLIENVLMDRKQEGPCSLLVYQRKGALLDSVVILGGQKAHGQFNDGVFAY
IIQENLWMKLSDMPYRAAALSATSAGRYIYISGGTTEQISGLKTAWRYDMDDNSWTKLPD
LPIGLVFHTMVTCGGTVYSVGGSIAPRRYVSNIYRYHERKEVWCLAGKMSIPMDGTAVIT
KGDRHLYIVTGRCLVKGYISRVGVVDCFDTSTGDVVQCITFPIEFNHRPLLSFQQDNILC
VHSHRQSVEINLQKVKASKTTTSVPVLPNSCPLDVSHAICSIGDSKVFVCGGVTTASDVQ
TKDYTINPNAFLLDQKTGKWKTLAPPPEALDCPACCLAKLPCKILQRI
Download sequence
Identical sequences G3SA27
XP_004048067.1.27298 ENSGGOP00000007297 ENSGGOP00000024948 ENSGGOP00000007297 ENSGGOP00000024948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]