SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025026 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025026
Domain Number 1 Region: 212-312
Classification Level Classification E-value
Superfamily Immunoglobulin 1.3e-26
Family C1 set domains (antibody constant domain-like) 0.00000527
Further Details:      
 
Domain Number 2 Region: 4-95
Classification Level Classification E-value
Superfamily Immunoglobulin 3.13e-22
Family C1 set domains (antibody constant domain-like) 0.00056
Further Details:      
 
Domain Number 3 Region: 109-206
Classification Level Classification E-value
Superfamily Immunoglobulin 9.36e-19
Family C1 set domains (antibody constant domain-like) 0.00000337
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025026   Gene: ENSGGOG00000023644   Transcript: ENSGGOT00000026648
Sequence length 338
Comment pep:known_by_projection chromosome:gorGor3.1:14:87664102:87665628:-1 gene:ENSGGOG00000023644 transcript:ENSGGOT00000026648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPTSPKVFPLSLCSTQPDGDVVVACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASG
DLYTTSSQLTLPATQCPDGKSVTCHVNHYTNPSQDVTVPCRAQAIPCCHPRLSLHRPALE
DLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVEGPPERDLCGCYSVSSVLPGCAEP
WNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGF
SPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMV
GHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY
Download sequence
Identical sequences ENSGGOP00000025026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]