SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025031 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025031
Domain Number 1 Region: 35-160
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000577
Family V set domains (antibody variable domain-like) 0.06
Further Details:      
 
Domain Number 2 Region: 255-348
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000153
Family I set domains 0.036
Further Details:      
 
Domain Number 3 Region: 156-252
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000464
Family C1 set domains (antibody constant domain-like) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025031   Gene: ENSGGOG00000006364   Transcript: ENSGGOT00000026620
Sequence length 525
Comment pep:known_by_projection chromosome:gorGor3.1:19:42073660:42096605:1 gene:ENSGGOG00000006364 transcript:ENSGGOT00000026620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APFVVALPGGVWVPPPPDYFTLCPLCPGAQDVRVQVLPEVRGQLGGTVELPCHLLPPVPG
LYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSSKPGSERLSFVSAKQSTGQDTEAELQD
ATLALHRLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPENQAQAQKVTFSQDPTTVAL
CISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEH
ESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGT
FPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGGII
GGIIAAIIATAVAATGILICRQQRKEQTLQGAEEDEDLEGPPSYKPPTPKAKLEAQEMPS
QLFTLGASEHSPLKTPYFDAGASCTEQEMPRYHELPTLEERSGPLHPGATSLGSPIPVPP
GPPAVEDVSLDYLDKINPIYDALSYSSPSDSYQGKGFVMSRAMYV
Download sequence
Identical sequences ENSGGOP00000025031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]