SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025082 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025082
Domain Number 1 Region: 109-202
Classification Level Classification E-value
Superfamily Immunoglobulin 2.84e-16
Family I set domains 0.048
Further Details:      
 
Domain Number 2 Region: 198-284
Classification Level Classification E-value
Superfamily Immunoglobulin 3.38e-16
Family I set domains 0.023
Further Details:      
 
Domain Number 3 Region: 20-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000771
Family I set domains 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025082   Gene: ENSGGOG00000011245   Transcript: ENSGGOT00000023607
Sequence length 286
Comment pep:known_by_projection chromosome:gorGor3.1:19:48659926:48666818:1 gene:ENSGGOG00000011245 transcript:ENSGGOT00000023607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAKAEPPPPSTGLLSQSLEFNSPADNYTVCEGDNATLSCFIDEHVTRVAWLNRSNILYAG
NDRWTSDPRVRLLINTPEEFSILITEVGLGDEGLYTCSFQTRHQPYTTQVYLIVHVPARI
VNISSPVTVNEGGNVNLLCLAVGRPEPTVTWRQLRDGFTSEGEILEISDIQRGQAGEYEC
VTHNGVNSAPDSRRVLVTVNYPPTITDVTSARTALGRAALLRCEAMAVPPADFQWYKDDR
LLSSGTAEGLKVQTERTRSMLLFANVSARHYGNYTCRAVRKAGTPN
Download sequence
Identical sequences ENSGGOP00000025082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]