SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025143 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025143
Domain Number 1 Region: 28-134
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-19
Family V set domains (antibody variable domain-like) 0.00032
Further Details:      
 
Domain Number 2 Region: 148-237
Classification Level Classification E-value
Superfamily Immunoglobulin 7.93e-16
Family C1 set domains (antibody constant domain-like) 0.049
Further Details:      
 
Domain Number 3 Region: 371-446
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000154
Family I set domains 0.014
Further Details:      
 
Domain Number 4 Region: 269-349
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000516
Family I set domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025143   Gene: ENSGGOG00000023573   Transcript: ENSGGOT00000030952
Sequence length 448
Comment pep:novel chromosome:gorGor3.1:19:47316846:47320789:1 gene:ENSGGOG00000023573 transcript:ENSGGOT00000030952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLPLLLLPLLLPVLAVGSLNKDPSYSLQVQRQVPVPEGLCVIVSCNLSYPRDGWDEST
AAYGYWFKGRTSPKTGAPVATNNQSREVEMSTRDRFQLTGDPGKGSCSLVIRDAQREDEA
WYFFRVERGSRVRHSFVNNAFFLKVTALTQKPDVYIPETLEPGQPVTVICVFNWAFKKCP
APSFSWTGAALSPRRTRPSTSHFSVLSFTPSPQDHDTDLTCHVDFSRKGVSAQRTVRLRV
AYAPKDLIISISHDDTSALELQENVIYLEVQKGQFLRLLCAADSQPPATLSWVLQDRVLS
SSHPWGPRTLGLELRGVKAGDSGRYTRRAENRLGSQQRALDLSVQYPPENLRVMVSQANR
TVLENLGNGTSLRVLEGQSLRLVCVTHSSPPARLSWTQRGQILSPSQPSDPGVLELPRVQ
MEHEGEFTCHAGHPLGSQRVSLSFSVHC
Download sequence
Identical sequences ENSGGOP00000025143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]