SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025192 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025192
Domain Number 1 Region: 1135-1439
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.23e-79
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000158
Further Details:      
 
Domain Number 2 Region: 878-1180
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.37e-71
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000315
Further Details:      
 
Domain Number 3 Region: 25-186
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-36
Family MAM domain 0.00000601
Further Details:      
 
Domain Number 4 Region: 386-585
Classification Level Classification E-value
Superfamily Fibronectin type III 3.87e-28
Family Fibronectin type III 0.00079
Further Details:      
 
Domain Number 5 Region: 284-420
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000126
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 6 Region: 189-282
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000311
Family I set domains 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025192   Gene: ENSGGOG00000006305   Transcript: ENSGGOT00000033239
Sequence length 1444
Comment pep:known_by_projection chromosome:gorGor3.1:1:30249391:30339374:1 gene:ENSGGOG00000006305 transcript:ENSGGOT00000033239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAQALVLALTFQLCAPETETPAAGCTFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGT
RAPADLPHGSYLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDGHSPGTLGVY
VRVNGGPLGSAVWNMTGSHGRQWHQAELAVSTFWPNEYQVLFEALISPDRRGYMGLDDIL
LLSYPCAKAPHFSRLGDVEVNAGQNASFQCMAAGRAAEAERFLLQRQSGALVPAAGVRHI
SHRRFLATFPLAAVSRAEQDLYRCVSQAPRGAGVSNFAELIVKEPPTPIAPPQLLRAGPT
YLIIQLNTNSITGDGPIVRKEIEYRMARGPWAEVHAVSLQTYKLWHLDPDTEYEISVLLT
RPGDGGTGRPGPPLISRTKCAEPMRAPKGLAFAEIQARQLTLQWEPLGYNVTRCHTYTVS
LCYHYTLGSSHNQTIRECVKTEQGVSRYTIKNLLPYRNVHVRLVLTNPEGRKEGKEVTFQ
TDEDVPSGIAAESLTFTPLEDMIFLKWEEPQEPNGLITQYEISYQSIESSDPAVNVPGPR
RTISKLRNETYHVFSNLHPGTTYLFSVRARTGKGFGQAALTEITTNISAPSFDYADMPSP
LGESENTITVLLRPAQGRGAPISVYQVIVEEERARRLRREPGGQDCFPVPLTFEAALARG
LVHYFGAELAASSLPEAMPFTVGDNQTYRGFWNPPLEPRKAYLIYFQAASHLKGETRLNC
IRIARKAACKESKRPLEVSQRSEEMGLILGICAGGLAVLILLLGAIIVIIRKGRDHYAYS
YYPKPVNMTKATVNYRQEKTHMMSAVDRSFTDQSTLQEDERLGLSFMDTHGYSTRGDQRS
SGVTEASSLLGGSPRRPCGRKGSPYHTGQLHPAVRVADLLQHINQMKTAEGYGFKQEYES
FFEGWDATKKKDKVKGSRQEPMPAYDRHRVKLHPMLGDPNADYINANYIDGYHRSNHFIA
TQGGKPGCGASWGAWQAKGAAKSPLSPVLWGLQVKCSRYWPEDSDTYGDIKITLVKTETL
AEYVVRTFALERRGYSARHEVRQFHFTAWPEHGVPYHATGLLAFIRRVKASTPPDAGPIV
IHCSAGTGRTGCYIVLDVMLDMAECEGVVDIYNCVKTLCSRRVNMIQTEEQYIFIHDAIL
EACLCGETTIPVSEFKATYKEMIRIDPQSNSSQLREEFQTLNSVTPPLDVEECSIALLPR
NRDKNRSMDVLPPDRCLPFLISTDGDPNNYINAALTDSYTRSAAFIVTLHPLQSTTPDFW
RLVYDYGCTSIVMLNQLNQSNSAWPCLQYWPEPGRQQYGLMEVEFMSGTADEDLVARVFR
VQNISRLQEGHLLVRHFQFLRWSAYRDTPDSKKAFLHLLAEVDKWQAESGDGRTIVHCLN
GGGRSGTFCACATVLEMIRCHNLVDVFFAAKTLRNYKPNMVETMDQYHFCYDVALEYLEG
LESR
Download sequence
Identical sequences ENSGGOP00000025192 ENSGGOP00000006179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]