SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025195 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025195
Domain Number 1 Region: 158-262
Classification Level Classification E-value
Superfamily C-type lectin-like 1.2e-39
Family Link domain 0.009
Further Details:      
 
Domain Number 2 Region: 268-352
Classification Level Classification E-value
Superfamily C-type lectin-like 7.76e-24
Family Link domain 0.0027
Further Details:      
 
Domain Number 3 Region: 49-155
Classification Level Classification E-value
Superfamily Immunoglobulin 8.91e-16
Family V set domains (antibody variable domain-like) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025195   Gene: ENSGGOG00000028491   Transcript: ENSGGOT00000024208
Sequence length 354
Comment pep:known_by_projection chromosome:gorGor3.1:5:66312415:66395414:-1 gene:ENSGGOG00000028491 transcript:ENSGGOT00000024208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLLLLVLISICWADHLSDNYTLDHDRVIHIQAENGPHLLVEAEQAKVFSHRGGNVTLP
CKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDS
DASLVITDLTLEDYGRYKCEVIEGLEDDTAVVALDLQGVVFPYFPRLGRYNLNFHEAQQA
CLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGF
WDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILG
YDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN
Download sequence
Identical sequences G3SAS2
XP_018884172.1.27298 XP_018884173.1.27298 ENSGGOP00000025195 ENSGGOP00000025195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]