SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025292 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025292
Domain Number 1 Region: 231-585
Classification Level Classification E-value
Superfamily L domain-like 1.36e-48
Family Ngr ectodomain-like 0.0032
Further Details:      
 
Domain Number 2 Region: 6-64
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000408
Family VWC domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025292   Gene: ENSGGOG00000013631   Transcript: ENSGGOT00000027645
Sequence length 604
Comment pep:known_by_projection chromosome:gorGor3.1:9:74404525:74428781:-1 gene:ENSGGOG00000013631 transcript:ENSGGOT00000027645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLGKKGHCLVKGITMYNKAVWSPEPCTTCLCSDGRVLCDETMCHPQRCPQTVIPEGECCP
VCSATVSYSLLSGIALNDRNEFSGDSSEQREPTNLLHKQLPPPQVGMDQIVRKEALQSKE
DEEVKEEDTEQKRETPESRNQGQLYSEGDSRGGDRKQRPGEERRLAHQQQRQGREEEEDE
EEEGEEGEEDEEDEEDPVRGDMFRMPSRSPLPAPPRGTLRLPSGCSLSYRTISCINAMLT
QIPPLTAPQITSLELTGNSIASIPDEAFNGLPNLERLDLSKNNITSSGIGPKAFKLLKKL
MRLNMDGNNLIQIPSQLPSTLEELKINENNLQAIDEESLSDLNQLVTLELEGNNLSEANV
NPLAFKPLKSLAYLRLGKNKFRIIPQGLPGSIEELYLENNQIEEITEICFNHTRKINVIV
LRYNKIEENRIAPLAWINQENLESIDLSYNKLYHVPSYLPKSLLHLVLLGNQIERIPGYV
FGHMEPGLEYLYLSFNKLADDGMDRVSFYGAYHSLRELFLDHNDLKSIPPGIQEMKALHF
LRLNNNKIRNILPEEICNAEEDDDSNLEHLHLENNYIKIREIPSYTFSCIRSYSSIVLKP
QNIK
Download sequence
Identical sequences ENSGGOP00000025292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]