SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025363 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025363
Domain Number 1 Region: 10-128
Classification Level Classification E-value
Superfamily POZ domain 1.69e-29
Family BTB/POZ domain 0.00078
Further Details:      
 
Domain Number 2 Region: 441-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.67e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 420-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000143
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 4 Region: 377-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000977
Family Classic zinc finger, C2H2 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025363   Gene: ENSGGOG00000028442   Transcript: ENSGGOT00000027423
Sequence length 531
Comment pep:known_by_projection chromosome:gorGor3.1:1:224569500:224573440:1 gene:ENSGGOG00000028442 transcript:ENSGGOT00000027423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPKGYEDSMEFPDHSRHLLQCLSEQRHQGFLCDCTVLVGDAQFRAHRAVLASCSMYFHL
FYKDQLDKRDIVHLNSDIVTAPAFALLLEFMYEGKLQFKDLPIEDVLAAASYLHMYDIVK
VCKKKLKEKATTEADSTKKEEDASSCSDKVESLSDGSSHMAGDLPSDEDEGEDEKLNILP
SKRDLAAEPGNMWMRLPSDSAGIPQAGGEAEPHATAAGKTVASPCSSTESLSQRSVTSVR
DSADVDCVLDLSVKSSLSGVENLNSSYFSSQDVLRSNLVQVKVEKEASCDESDVGTNDYD
MEHSTVKESVSTNNRVQYEPAHLAPLREDSVLRELDREDKASDDEMMTPESERVQVEGGM
ESSLLPYVSNILSPAGQIFMCPLCNKVFPSPHILQIHLSTHFREQDGIRSKPAADVNVPT
CSLCGKTFSCMYTLKRHERTHSGEKPYTCTQCGKSFQYSHNLSRHAVVHTREKPHACKWC
ERRFTQSGDLYRHIRKFHCELVNSLSVKSEALSLPTVRDWTLEDSSQELWK
Download sequence
Identical sequences A0A096MXN0 A0A286Y481 A0A2K5NC99 A0A2K5XQ34 A0A2K6MQQ3 A0A2K6R0Q5 G3SB87 H2Q1F5 H9EN14 I3M3Y2
ENSPANP00000004653 NP_001244821.1.72884 XP_003808044.1.60992 XP_004028730.1.27298 XP_004626888.1.9945 XP_005326624.1.77405 XP_005374830.1.28644 XP_006974277.1.50099 XP_007988176.1.81039 XP_011836555.1.47321 XP_011891714.1.92194 XP_017725871.1.44346 XP_525117.2.37143 ENSGGOP00000025363 ENSGGOP00000025363 ENSPTRP00000003681 ENSMMUP00000020548 ENSMMUP00000020548 ENSPTRP00000003681 9544.ENSMMUP00000020548 9598.ENSPTRP00000003681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]