SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025370 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000025370
Domain Number - Region: 284-327
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00615
Family Frizzled cysteine-rich domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025370   Gene: ENSGGOG00000027076   Transcript: ENSGGOT00000024140
Sequence length 472
Comment pep:known_by_projection chromosome:gorGor3.1:X:66688475:66713220:1 gene:ENSGGOG00000027076 transcript:ENSGGOT00000024140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRGAWMWPGKDAAALTICCCCCCWAPRPSDKPCADSERAQRWRLSLASLLFFTVLLADH
LWLCAGARPRARELSSAMRPPWGAGRERQPVPPRAVLPLPPPPPGEPSAPPGTCGPRYSN
LTKAAPAAGSRPVCGGVPEPTGLDAACTKLQSLQRLFEPTTPAPPLRPPDSPSRAPAEFP
SAKKNLLKGHFRNFTLSFCDTYTVWDLLLGMDRPDSLDCSLDTLLGDLLAVVASPGSGAW
EACSNCIEAYQRLDRHAQEKYDEFDLVLHKYLQAEEYSIRSCTKGCKAVYKAWLCSEYFS
VTQQECQRWVPCKQYCLEVQTQCPFILPDNEEMVYGGLPGFICTGLLDTSPKHLETKCCD
VQWVSCEAKKKKFKESEAPKTHHQQFHHSYFHHYHQQYHHYHPRHDPPGRVSNKPALLPV
SGGSRLSPSRIRLCVLVLMLLHTVVSFSSNQGGGGLGLETLPALEEGLTREE
Download sequence
Identical sequences ENSGGOP00000025370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]