SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025397 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025397
Domain Number 1 Region: 22-140
Classification Level Classification E-value
Superfamily Lysozyme-like 3.52e-58
Family C-type lysozyme 0.00000694
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025397   Gene: ENSGGOG00000025788   Transcript: ENSGGOT00000032533
Sequence length 142
Comment pep:known_by_projection chromosome:gorGor3.1:12:46507432:46509807:-1 gene:ENSGGOG00000025788 transcript:ENSGGOT00000032533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFFVPLFLVGILFPAILAKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAI
VENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGI
DYWLAHKALCTEKLEQWLCEKL
Download sequence
Identical sequences A0A080YV01 G3SBC1 P00709
ENSP00000301046 ENSGGOP00000025397 1hmlA 1hml_A ENSGGOP00000025397 gi|4504947|ref|NP_002280.1| ENSP00000301046 NP_002280.1.87134 NP_002280.1.92137 XP_004053098.1.27298 ENSP00000301046 9606.ENSP00000301046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]