SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025399 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025399
Domain Number 1 Region: 20-118
Classification Level Classification E-value
Superfamily Immunoglobulin 7.01e-49
Family V set domains (antibody variable domain-like) 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025399   Gene: ENSGGOG00000025800   Transcript: ENSGGOT00000022885
Sequence length 120
Comment pep:novel chromosome:gorGor3.1:14:88199012:88199468:-1 gene:ENSGGOG00000025800 transcript:ENSGGOT00000022885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGLSWIFLFAILKGVQCEVQLVESGGGLVQPGRSLRLSCVASGFTFDDYAMHWVRQAP
GKGLEWVSGISWNSGSTGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKDTQ
Download sequence
Identical sequences ENSGGOP00000025399 ENSGGOP00000025399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]