SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025502 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025502
Domain Number 1 Region: 148-235
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000204
Family C1 set domains (antibody constant domain-like) 0.029
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000025502
Domain Number - Region: 103-157
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00312
Family I set domains 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025502   Gene: ENSGGOG00000001722   Transcript: ENSGGOT00000022363
Sequence length 262
Comment pep:known_by_projection chromosome:gorGor3.1:3:112123377:112128303:-1 gene:ENSGGOG00000001722 transcript:ENSGGOT00000022363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLCPIWTETNVSLNLIFFMLSFLASSSSCMDGKQMTQNYSTIFAEGNISQPVLMDTNAVL
CFPPIALRNLIIITWEIILRDQPSCTKAYRKETNETKETNCTVERITWVSRPDQNSDLQI
RPVDTTHDGYYRGIVVTPDGNFHRGYHLQVLVTPEVTLFQSRNRTAVCKAVAGKPAAQIS
WIPEGSILATKQEYWGNGTVTVKSTCHWEGHKSTVTCHVSHLTGNKSLSVKLNSVPTFNP
NSKSFFPFISLGAFLHSPLSFV
Download sequence
Identical sequences ENSGGOP00000025502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]