SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025510 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025510
Domain Number 1 Region: 345-444
Classification Level Classification E-value
Superfamily Immunoglobulin 7.01e-28
Family C1 set domains (antibody constant domain-like) 0.00039
Further Details:      
 
Domain Number 2 Region: 241-338
Classification Level Classification E-value
Superfamily Immunoglobulin 1.76e-23
Family C1 set domains (antibody constant domain-like) 0.0019
Further Details:      
 
Domain Number 3 Region: 22-115
Classification Level Classification E-value
Superfamily Immunoglobulin 4.55e-22
Family C1 set domains (antibody constant domain-like) 0.00000441
Further Details:      
 
Domain Number 4 Region: 126-225
Classification Level Classification E-value
Superfamily Immunoglobulin 1.92e-21
Family C1 set domains (antibody constant domain-like) 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000025510
Domain Number - Region: 2-31
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000233
Family C1 set domains (antibody constant domain-like) 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025510   Gene: ENSGGOG00000024634   Transcript: ENSGGOT00000022693
Sequence length 470
Comment pep:known_by_projection chromosome:gorGor3.1:14:87982488:87991575:-1 gene:ENSGGOG00000024634 transcript:ENSGGOT00000022693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DNWFDPWGQGTLVTVSSGSASAPTLFPLVSCENSPSDTSSVAVGCLAQDFLPDSITFSWK
YKNNSDISSTQGFPSVLRGGKYAATSQVLLPSKEVMQGTDEHVVCKVQHPNGNKEKNVPL
PVIAELPPKVSVFVPPRDGFFGNPRKSKLICQATGFSPRQIQVSWLREGKQVGSGVTTDQ
VQAEAKESGPTTYKVTSTLTIKESDWLSQSMFTCRVDHRGLTFQQNASSMCSPDQDTAIR
VFAIPPSFASIFLTKSTKLTCLVTDLTTYDSVTISWTRQNGEAVKTHTNISESHPNTTFS
AVGEASICEDDWNSGERFTCTVTHTDLPSPLKQTISRPKGVALHRPDVYLLPPAREQLNL
RELATITCLVTGFSPADVFVQWMQRGQPLSPEKYVTSAPMPEPRAPGRYFAHSILTVSEE
EWNTGETYTCVVAHEALPNRVTERTVDKSTGKPTLYNVSLVMSDTAGTCY
Download sequence
Identical sequences ENSGGOP00000025510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]