SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025540 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025540
Domain Number 1 Region: 187-303
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 1.22e-42
Family eIF-2-alpha, C-terminal domain 0.000000524
Further Details:      
 
Domain Number 2 Region: 90-183
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 1.31e-33
Family eIF2alpha middle domain-like 0.00000188
Further Details:      
 
Domain Number 3 Region: 17-93
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000018
Family Cold shock DNA-binding domain-like 0.0000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025540   Gene: ENSGGOG00000001603   Transcript: ENSGGOT00000028711
Sequence length 315
Comment pep:known_by_projection chromosome:gorGor3.1:14:48465868:48487920:1 gene:ENSGGOG00000001603 transcript:ENSGGOT00000028711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YPGYDFRLVDHKRSSAESRVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV
DGDDDAEEMEAKAED
Download sequence
Identical sequences ENSGGOP00000025540 ENSGGOP00000025540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]