SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025613 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025613
Domain Number 1 Region: 288-376
Classification Level Classification E-value
Superfamily Immunoglobulin 7.34e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 2 Region: 372-468
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000639
Family I set domains 0.032
Further Details:      
 
Domain Number 3 Region: 6-88
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000335
Family I set domains 0.044
Further Details:      
 
Domain Number 4 Region: 204-289
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000283
Family I set domains 0.016
Further Details:      
 
Domain Number 5 Region: 138-205
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000101
Family C1 set domains (antibody constant domain-like) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025613   Gene: ENSGGOG00000005038   Transcript: ENSGGOT00000031560
Sequence length 732
Comment pep:known_by_projection chromosome:gorGor3.1:11:124618482:124720905:-1 gene:ENSGGOG00000005038 transcript:ENSGGOT00000031560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQVYSFSQQPQDQVVVSGQPVTLLCAIPEYDGFVLWIKDGLALGVGRDLSSYPQYLVVGN
HLSGEHHLKILRAELQDDAVYECQAIQAAIRSRPARLTVLAEKSVGRPSCPPVVSLRWRY
PASHKAHIKEMKPRGGGWERHGAFSPLSPSPKTLLRDGKRESIVSTLFISPGDVENGQSI
VCRATNKAIPGGKETSVTIDIQHPPLVNLSVEPPVLEDNVVTFHCSAKANPAVTQYRWAK
RGQIIKEASGEVYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTTEPQSLLV
DLGSDAIFSCAWTGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVG
AGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSG
RYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMKSGAG
LEAESVPMAVIIGVAVGAGVAFLVLMATIVAFCCARSQRNLKGVVSAKNDIRVEIVHKEP
ASGREAEEHSTIKQLMMDRGEFQQDSVLKQLEVLKEEEKEFQNLKDPTNGYYSVNTFKEH
HSTPTISLSSCQPDLRPAGKQRVPTGMSFTNIYSTLSGQGRLYDYGQRFVLGMGSSSIEL
CEREFQRGSLSDSSSFLDTQCDSSVSSSGKQDGYVQFDKASKASASSSHHSQSSSQNSDP
SRPLQRRMQTHV
Download sequence
Identical sequences ENSGGOP00000025613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]