SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025646 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025646
Domain Number 1 Region: 34-391
Classification Level Classification E-value
Superfamily L domain-like 3.4e-61
Family Ngr ectodomain-like 0.059
Further Details:      
 
Domain Number 2 Region: 424-516
Classification Level Classification E-value
Superfamily Immunoglobulin 6.71e-19
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 527-603
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000424
Family Fibronectin type III 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025646   Gene: ENSGGOG00000022843   Transcript: ENSGGOT00000027648
Sequence length 716
Comment pep:known_by_projection chromosome:gorGor3.1:3:3936909:3985950:1 gene:ENSGGOG00000022843 transcript:ENSGGOT00000027648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARMSFVIAACQLVLGLLMTSLTESSIQNSECPQLCVCEIRPWFTPQSTYREATTVDCND
LRLTRIPSNLSSDTQVLLLQSNNIAKTVDELQQLFNLTELDFSQNNFTNIKEVGLANLTQ
LTTLHLEENQITEMTDYCLQDLSNLQELYINHNQISTISAHAFAGLKNLLRLHLNSNKLK
VIDSRWFDSTPNLEILMIGENPVIGILDMNFKPLANLRSLVLAGMYLTDIPGNALVGLDS
LESLSFYDNKLVKVPQLALQKVPNLKFLDLNKNPIHKIQEGDFKNMLRLKELGINNMGEL
VSVDRYALDNLPELTKLEATNNPKLSYIHRLAFRSVPALESLMLNNNALNAIYQKTVESL
PNLREISIHSNPLRCDCVIHWINSNKTNIRFMEPLSMFCAMPPEYKGHQVKEVLIQDSSE
QCLPMISHDTFPNRLNVDIGTTVFLDCRAMAEPEPEIYWVTPTGNKITVETLSDKYKLSS
EGTLEISNIQIEDSGRYTCVAQNVQGADTRVATIKVNGTLLDGTQVLKIYVKQTESHSVL
VSWKVNSNVMTSNLKWSSATMKIDNPHITYTARVPVDVHEYNLTHLQPSTDYEVCLTVSN
IHQQTQKSCVNVTTKNAAFALDISDQETSTALAAVMGSMFAVISLASIAVYFAKRFKRKN
YHHSLKKYMQKTSSIPLNELYPPLINLWEGDSEKDKDGSADTKPTQVDTSRSYYMW
Download sequence
Identical sequences G3SC19
XP_004033569.1.27298 XP_018879823.1.27298 ENSGGOP00000025646 ENSGGOP00000025646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]