SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025693 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025693
Domain Number 1 Region: 426-608
Classification Level Classification E-value
Superfamily Fibronectin type III 3.58e-36
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 2 Region: 332-427
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-26
Family I set domains 0.0065
Further Details:      
 
Domain Number 3 Region: 144-232
Classification Level Classification E-value
Superfamily Immunoglobulin 2.92e-18
Family I set domains 0.015
Further Details:      
 
Domain Number 4 Region: 47-137
Classification Level Classification E-value
Superfamily Immunoglobulin 9.88e-18
Family I set domains 0.0081
Further Details:      
 
Domain Number 5 Region: 241-332
Classification Level Classification E-value
Superfamily Immunoglobulin 3.75e-17
Family I set domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025693   Gene: ENSGGOG00000010452   Transcript: ENSGGOT00000028737
Sequence length 815
Comment pep:known_by_projection chromosome:gorGor3.1:15:44599417:44651175:-1 gene:ENSGGOG00000010452 transcript:ENSGGOT00000028737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVQRAASPRRPLAPCWPPRRARTNTPISFHLPFPNAGLGHSAELAFAVEPSDDVAVPGQ
PIVLDCRVEGTPPVRITWRKNGVELPESPHSTLLANGSLMIRHFRLERGGSPSDEGDYEC
VAQNRFGLVVSRKARIQAATMSDFHVHPQATVGEEGGVARFQCQIHGLPKPLITWEKNRV
PIDTDNERYTLLPKGVLQITGLRAEDSGIFHCVASNIASIRISHGARLTVSGSGSGAYKE
PAILVGPENLTLTVHQTAVLECVATGNPRPIVSWSRLDGRPIGVEGIQVLGTGNLIISDV
TVQHSGVYVCAANRPGTRVRRTAQGRLVVQAPAEFVQHPQSISRPAGTTAMFTCQAQGEP
PPHVTWLKNGQVLGPGGHVRLKNNNSTLTISGIGPEDEAIYQCVAENSAGSSQASARLTV
LWAEGLPGPPRNVRAVSVSSTEVRVSWSEPLANTKEIIGYVLHIRKAADPPELEYQEAVS
KSTFQHLVSDLEPSTAYSFYIKAYTPRGASSASVPTLVSTLGEAPAPPPLSVRVLGSSSL
QLLWEPWPRLAQHEGGFKLFYRPASKTSFTGPILLPGTVSSYNLSQLDPTTVYEVKLLAY
NQHGDGNATVRFVSLRGASERTVLSPPCDCRKEEAANQTSTTGIVIGIHIGVTCIIFCVL
FLLFGQRGRVLWCKDVENQLSPPQGPRSQRDPGILALNGARRGERGRLGRDEKRVDMKEL
EQLFPPAGTAGQPDPRPTQDPAAPAPCEETQLSVLPLQGCGLMEGKTTEAKTTEATAPCA
GLAAEPPSPLGRVRLGQEGAGGPPGLTWVLSHSAH
Download sequence
Identical sequences ENSGGOP00000010198 ENSGGOP00000025693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]