SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025694 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025694
Domain Number 1 Region: 28-136
Classification Level Classification E-value
Superfamily Immunoglobulin 2.97e-20
Family V set domains (antibody variable domain-like) 0.0000431
Further Details:      
 
Domain Number 2 Region: 155-240
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-16
Family I set domains 0.044
Further Details:      
 
Domain Number 3 Region: 269-339
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000277
Family I set domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025694   Gene: ENSGGOG00000002802   Transcript: ENSGGOT00000027639
Sequence length 494
Comment pep:known_by_projection chromosome:gorGor3.1:19:48794463:48801315:-1 gene:ENSGGOG00000002802 transcript:ENSGGOT00000027639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEVPTLLLLREWGTKGMEGDRQYGDGYLLQVQELVTVQEGLCVHVPCSFSYPQDGWTYSD
PVHGYWFRAGDRPYQDAPVATNNPDREVQAETQGRFQLLGDIWSNDCSLSIRDARKRDKG
SYFFRLERGSMKWSYKSQLNYKAKQLSVFVTALTHRPDILILGTLESGHPRNLTCSAPWA
CKQGTPPMISWIGASVSSPGPTTARSSVLTLIPKPQDHGTSLACQVTLPGTGVTTTSTVR
LNVSYPPWNLTMTVFQGDATASTALGNGSSLSVLEGQSLRLVCAVNSNPPARLSWTWGSL
TLCPSRSSNPGLLELPRVHVRDEGEFTCRAQNPQGSQHISLSLSLQNEGTGTSRPVSEVT
LAAVGGAGATALAFLSFCIIFIIVRSCRKKSARPAAGMEDAKAIRGSASQGPLTESWKDG
NPPKKPPPAVAPSSGEEGELHYATLSFHKVKPQDPQGQEATDSEYSEIKIHKRETAETQA
CLRNHNPSSKEVRG
Download sequence
Identical sequences ENSGGOP00000025694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]