SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025695 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025695
Domain Number 1 Region: 90-182
Classification Level Classification E-value
Superfamily Immunoglobulin 2.7e-18
Family I set domains 0.04
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000025695
Domain Number - Region: 256-322
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00589
Family Rhamnogalacturonase B, RhgB, middle domain 0.034
Further Details:      
 
Domain Number - Region: 630-724
Classification Level Classification E-value
Superfamily Vitelline membrane outer protein-I (VMO-I) 0.0811
Family Vitelline membrane outer protein-I (VMO-I) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025695   Gene: ENSGGOG00000005993   Transcript: ENSGGOT00000027798
Sequence length 889
Comment pep:known_by_projection chromosome:gorGor3.1:19:19920064:19925748:1 gene:ENSGGOG00000005993 transcript:ENSGGOT00000027798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASEWTSWFNVDHPGGDGDFESLAAIRFYYGQRACARPLALEARTTDWALPSAVGERVHEP
YAGFWCLNREQPRGRRCSNYHVRFRCPLEKPYLVKHPESRVREAGQNVTFCCKASGTPMP
KKYSWFHNGTLLDRQAHGYGAHLELRGLRPDQAGIYHCKAWNEAGAVRSGTARLTVLPGP
EYLIKLPEDCGQPGSGPAYLDVGLCPDTRCPSLAGSSPRCGDAMLLCAVERREIHCPGYV
LPVKVVAECGCQKCLPPRGLVRGRIVAADSGEPLRFARILLGREPIGFTAYQGDFTIEVP
PSTQRLVVTFVDQREFMDAVRVLPFDPRGAGVYHEVKPCGRKPVILHASQSNTIPLGELE
DEAPLGELVLPSGAFRRADGKPYSGPVEARVTFVDPRDLTSAASAPSDLRFVDSDGELAP
LRTYGMFSVDLRAPGSAEQLQVGPVAVRVAASQIHMPGHVEALKLWSLNPETGLWEEESG
FRREEERVFLVGNVEIRERRLFNLDVPERRRCFVKVRAYANDKFTPSEQVEGVVVTLVNL
EPAPGFSVNPRAWGRFDSAVTGPNGACLPAFCDADRPDAYTALVTATLGGEELEPAPSLP
RPLPATVGVTQPYLDRLGYRRTDHDDRLQATARINLAKPRPGDPAEANGPVYPWRSLREC
QGAPVTASHFRFARVEADKYEYNVVPFREGTPASWTGDLLAWWPNPQEFRACFLKVKIQG
PQEYMVRSHNAGGSHPRTRGQLYGLRDARSVRDPERPGTSAACVEFKCSGMLFDQRQVDR
TLVTIMPQGSCRRVAVNGLLRDYLTRHPPLVPAEDPAAFSMLAPLDPLGHNYGVYTVTDQ
SPRLAKEIAIGRCFDGSSDGFSREMKADAGTAVTFQCREPPAGRPSLFQ
Download sequence
Identical sequences ENSGGOP00000025695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]