SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025707 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025707
Domain Number 1 Region: 688-890
Classification Level Classification E-value
Superfamily Fibronectin type III 1.71e-38
Family Fibronectin type III 0.00034
Further Details:      
 
Domain Number 2 Region: 359-584
Classification Level Classification E-value
Superfamily Fibronectin type III 2.5e-37
Family Fibronectin type III 0.00081
Further Details:      
 
Domain Number 3 Region: 1330-1417
Classification Level Classification E-value
Superfamily Immunoglobulin 4.35e-20
Family I set domains 0.011
Further Details:      
 
Domain Number 4 Region: 585-684
Classification Level Classification E-value
Superfamily Fibronectin type III 3.11e-19
Family Fibronectin type III 0.00086
Further Details:      
 
Domain Number 5 Region: 355-417,909-972
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000002
Family I set domains 0.053
Further Details:      
 
Domain Number 6 Region: 1107-1192
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000879
Family I set domains 0.032
Further Details:      
 
Domain Number 7 Region: 1224-1287
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000972
Family V set domains (antibody variable domain-like) 0.046
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000025707
Domain Number - Region: 151-193
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000105
Family I set domains 0.04
Further Details:      
 
Domain Number - Region: 1006-1083
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00333
Family I set domains 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025707   Gene: ENSGGOG00000002794   Transcript: ENSGGOT00000025007
Sequence length 1444
Comment pep:known_by_projection chromosome:gorGor3.1:8:1928899:2010571:1 gene:ENSGGOG00000002794 transcript:ENSGGOT00000025007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLVTVPFYQKRHRHFDQSYRNIQTRYLLDEYASKKRASTQASSQKSLSQRSSSQRTSSQ
TSLGGTICRLCAKRVSTQEDEEQENRSRYQSLVAAYGETKRQRFLSELAHLEEDVHLARS
QARDKLDKYAIQQMMEDKLAWERHTFEERIRRAPEILVRLRSHTVWERMSVKLCFTVQGF
PTPVVQWFRGSLLAEAQLTYKEGVRALLRHVAAAALRVPGLPAPSRSARHPYLLPKFSPS
HLPPAPVGCRTHPYIFMIIFCIVSIRSELKGRTVSLKNISSEKKEKKCQPNVSHPPHDLM
TKNCRLKCFIKDSMFCLSPTHQSKKYSSTLNMRIKQWSNQGRVPFLSLPQDADPLVTGAP
GAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNNWVQCNDAPVKICKYP
VTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRSLQAVHLEGEKEMAIYQDD
LEGDAQVPGPPTGVHASEISRNYVVLSWEPPIPRGKDPLMYFIEKSVVGSGSWQRVNAQT
AVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDVTGKVVPSAPGRVLAS
RNTKTSVVVQWERPKHEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNRFVVHGLTTGEQYI
FRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMTLGWKVPKFSGGSP
ILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSE
HFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWIT
VNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSETSEPVLVEARPGTKEISAGVD
EQGNIYLGFDCQEMTDASQFTWCKSYEEIADDERFKIETVGDHSKLYLKNPDKEDLGTYS
VSVSDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHL
SPDASYRFIINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQS
SLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRLVCKVANTKKETVF
KWLKDDVLYETEKLPNLERGICELLIPKLSKKDHGEYKATLKDDRGQDVSILEIAGKVYD
DMILAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTEEMKVNWCHKDAKISSSEHMRIGG
SEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFAEFQQLKAAAFAEK
NRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYV
SMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAPPQQAKPKLIPASAS
AAGQ
Download sequence
Identical sequences ENSGGOP00000025707 ENSGGOP00000002765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]