SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025715 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025715
Domain Number 1 Region: 136-238
Classification Level Classification E-value
Superfamily Immunoglobulin 4.78e-28
Family C1 set domains (antibody constant domain-like) 0.00000449
Further Details:      
 
Domain Number 2 Region: 22-138
Classification Level Classification E-value
Superfamily Immunoglobulin 1.08e-26
Family V set domains (antibody variable domain-like) 0.0000384
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025715   Gene: ENSGGOG00000023976   Transcript: ENSGGOT00000023036
Sequence length 240
Comment pep:novel chromosome:gorGor3.1:2a:90317210:90428386:-1 gene:ENSGGOG00000023976 transcript:ENSGGOT00000023036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVPAQLLGLLLLWLPGSSGDIEMTQHLLSLPVPPGEPASISCRSSQSLLHSDGNTYLDW
YLQKPGQSPQLLIYTISNKFYGVPNKFSGSRSGTGFTLKFSKVEAEDEGFLFSKTIESSH
WWTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNVL
QSGNSQESVTEQDSKDNTYSLSSTLTLSKAEYEKHKAYACEVTHQGLSSPVTKSFNRGEC
Download sequence
Identical sequences ENSGGOP00000025715 ENSGGOP00000025715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]