SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025721 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025721
Domain Number 1 Region: 26-113
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.8e-26
Family Ribosomal L11/L12e N-terminal domain 0.0000141
Further Details:      
 
Domain Number 2 Region: 102-175
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 4.45e-17
Family Ribosomal protein L11, C-terminal domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025721   Gene: ENSGGOG00000022825   Transcript: ENSGGOT00000025068
Sequence length 195
Comment pep:novel chromosome:gorGor3.1:19:13411092:13412092:-1 gene:ENSGGOG00000022825 transcript:ENSGGOT00000025068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLSAWRSPRCNFLQSSRIQVFPTPITSTMLPKFNPNEIKFVYLRCTRGEGGATSALAPKI
GPLGLSPKKLGNDLAKAGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRK
KEKNIRHNGNITFDEIVNITRQMQHRSLARELSGTIKEILGTAQSVGCNVDGRHPRDIID
DINSGDSGAVKCPAS
Download sequence
Identical sequences ENSGGOP00000025721 ENSGGOP00000025721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]