SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025835 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025835
Domain Number 1 Region: 391-547
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.66e-29
Family Toll/Interleukin receptor TIR domain 0.00051
Further Details:      
 
Domain Number 2 Region: 29-136
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000154
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 239-344
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000232
Family I set domains 0.037
Further Details:      
 
Domain Number 4 Region: 153-264
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000599
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025835   Gene: ENSGGOG00000012048   Transcript: ENSGGOT00000032529
Sequence length 567
Comment pep:known_by_projection chromosome:gorGor3.1:3:192211285:192260580:1 gene:ENSGGOG00000012048 transcript:ENSGGOT00000032529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLCCKMTHLPFLSFLIIPERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHS
AGLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCS
KVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQKITCPNVDGYFPSSVKPTITWYMGCYK
IQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNAVPP
VIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINESIS
HSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVELACG
FGATVLLVVILIVVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEFVLL
TLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPNYVLQGTQALLEL
KAGLENMASRGNINVILVQYKAVKETKVKELKRAKTVLTVIKWKGEKSKYPQGRFWKQLQ
VAMPVKKSPRRSSSDEQGLSYSSLKNV
Download sequence
Identical sequences ENSGGOP00000025835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]