SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025860 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025860
Domain Number 1 Region: 1333-1645
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.12e-111
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000161
Further Details:      
 
Domain Number 2 Region: 1610-1899
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.34e-98
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000619
Further Details:      
 
Domain Number 3 Region: 333-527
Classification Level Classification E-value
Superfamily Fibronectin type III 3.83e-47
Family Fibronectin type III 0.0005
Further Details:      
 
Domain Number 4 Region: 621-827
Classification Level Classification E-value
Superfamily Fibronectin type III 1.32e-40
Family Fibronectin type III 0.0004
Further Details:      
 
Domain Number 5 Region: 827-1014
Classification Level Classification E-value
Superfamily Fibronectin type III 2.33e-40
Family Fibronectin type III 0.00068
Further Details:      
 
Domain Number 6 Region: 516-625
Classification Level Classification E-value
Superfamily Fibronectin type III 3.05e-20
Family Fibronectin type III 0.0000961
Further Details:      
 
Domain Number 7 Region: 47-149
Classification Level Classification E-value
Superfamily Immunoglobulin 1.18e-18
Family I set domains 0.003
Further Details:      
 
Domain Number 8 Region: 245-338
Classification Level Classification E-value
Superfamily Immunoglobulin 1.72e-17
Family I set domains 0.012
Further Details:      
 
Domain Number 9 Region: 150-242
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-16
Family I set domains 0.028
Further Details:      
 
Domain Number 10 Region: 1023-1106
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000436
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025860   Gene: ENSGGOG00000009263   Transcript: ENSGGOT00000026394
Sequence length 1907
Comment pep:known_by_projection chromosome:gorGor3.1:1:45029620:45118435:1 gene:ENSGGOG00000009263 transcript:ENSGGOT00000026394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDCPGLWLAVELEPWMAPEPAPGRTMVPLVPALVMLGLVAGAHGDSKPVFIKVPEDQTGL
SGGVASFVCQATGEPKPRITWMKKGKKVSSQRFEVIEFDDGAGSVLRIQPLRVQRDEAIY
ECTATNSLGEINTSAKLSVLEEEQLPPGFPSIDMGPQLKVVEKARTATMLCAAGGNPDPE
ISWFKDFLPVDPATSNGRIKQLRSGALQIESSEESDQGKYECVATNSAGTRYSAPANLYV
RVRRVAPRFSIPPSSQEVMPGGSVNLTCVAVGAPMPYVKWMMGAEELTKEDEMPVGRNVL
ELSNVVRSANYTCVAISSLGMIEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSGNSE
PVTYYGIQYRAAGTEGPFQEVDGVATTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVR
ARTGEQAPSSPPRRVQARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPPNAWHKH
NTDAGLLTTVGSLLPGITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQAEVESD
TRIQLSWLLPPQERIIMYELVYWVAEDEDQQHKVTFDPTSSYTLEDLKPDTLYRFQLAAR
SDMGVGVFTPTIEARTAQSTPSAPPQKVMCVSMGSTTVRVSWVPPPADSRNGVITQYSVA
YEAVDGEDRGRHVVDGISREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDE
DVPSGPPRKVEVEPLNSTAVHVYWKLPVPSKQHGQIRGYQVTYVRLENGEPRGLPIIQDV
MLAEAQETTISGLTPETTYSITVAAYTTKGDGARSKPKIVTTTGAVPGRPTMMISTTAMN
TALLQWHPPKELPGELLGYRLQYCRADEARPNTIDFGKDDQHFTVTGLHKGTTYIFRLAA
KNRAGLGEEFEKEIRTPEDLPSGFPQNLRVTGLTTSTTELAWDPPVLAERNGRITSYTVV
FRDINSQQELQNITTDTRFTLTGLKPDTTYDIKVRAWTSKGSGPLSPSIQSRTMPVEQVF
AKNFRVAAAMKTSVLLSWEVPDSYKSAVPFKILYNGQSVEVDGHSMRKLIADLQPNTEYS
FVLMNRGSSAGGLQHLVSIRTAPDLLPHKPLPASAYIEDGRFDLSMPHVQDPSLVRWFYI
VVVPIDRVGGSMLTPRWSTPEELELDELLEAIEQGGEQAERLKPYVAAQLDVLPETFTLG
DKKNYRGFYNRPLSPDLSYQCFVLASLKEPMDQKRYASSPYSDEIVVQVTPAQQQEEPEM
LWVTGPVLAVILIILIVIAILLFKRKRTHSPSSKDEQSIGLKDSLLAHSSDPVEMRRLNY
QTPGMRDHPPIPITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNLEVNKPKNRY
ANVIAYDHSRVILTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQ
RTATVVMMTRLEEKSRVKCDQYWPARGTETYGLIQVTLLDTVELATYTVRTFALHKSGSS
EKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVI
DAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAATCGHTEVPARNLY
AHIQKLGQVPPGESVTAMELEFKLLASSKAHTSRFISANLPCNKFKNRLVNIMPYELTRV
CLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKL
REMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFT
DWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSSAGVGRTGVFITLSIVLERMR
YEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFDHYAT
Download sequence
Identical sequences ENSGGOP00000025860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]