SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025880 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025880
Domain Number 1 Region: 770-965
Classification Level Classification E-value
Superfamily Fibronectin type III 1.51e-39
Family Fibronectin type III 0.0000379
Further Details:      
 
Domain Number 2 Region: 655-769
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-16
Family I set domains 0.00000235
Further Details:      
 
Domain Number 3 Region: 448-533
Classification Level Classification E-value
Superfamily Immunoglobulin 2.11e-16
Family I set domains 0.0017
Further Details:      
 
Domain Number 4 Region: 157-258
Classification Level Classification E-value
Superfamily Immunoglobulin 2.16e-16
Family I set domains 0.00000226
Further Details:      
 
Domain Number 5 Region: 1090-1159
Classification Level Classification E-value
Superfamily Immunoglobulin 4.11e-16
Family I set domains 0.0075
Further Details:      
 
Domain Number 6 Region: 369-459
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000381
Family I set domains 0.0000163
Further Details:      
 
Domain Number 7 Region: 545-622
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000244
Family I set domains 0.0054
Further Details:      
 
Domain Number 8 Region: 12-97
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000918
Family I set domains 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025880   Gene: ENSGGOG00000006471   Transcript: ENSGGOT00000029026
Sequence length 1160
Comment pep:known_by_projection chromosome:gorGor3.1:11:48096293:48115395:-1 gene:ENSGGOG00000006471 transcript:ENSGGOT00000029026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPELGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATE
GTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEA
PAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTMGGSITFSARVAG
ASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFAGGYRCE
VSTKDKFDCSNFNLTVHEAVGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLK
KSSSFRTPRDSKLEAPAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEK
KSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRT
LTISQCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEE
GAQVKWLKDGVELTREETFKYRFKKDGRRHHLIINEATLEDAGHYALRTSGGQALAELIV
QEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHK
LTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIV
VVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCE
TEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKI
SNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGV
VYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDISDTTVSLKWRPPERVGAGG
LDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTE
PVTVQEILLTRPAIDTPGPWCPVEVRTVGEAQNALPRTLGRDRRGWSHRPCARPXIGPDV
EQSSPQPVSPAFSPPWGVWTGFLPLGRAVVLTVGSMFVSSLGHSQGLSWDPPSRNTDVSP
WVPARSPLSLDGFPPPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCR
ATNLQGEARCECRLEVRVPQ
Download sequence
Identical sequences ENSGGOP00000006336 ENSGGOP00000025880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]