SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025896 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025896
Domain Number 1 Region: 135-248
Classification Level Classification E-value
Superfamily C-type lectin-like 2.06e-30
Family C-type lectin domain 0.00000577
Further Details:      
 
Domain Number 2 Region: 104-129
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.0000000595
Family Triple coiled coil domain of C-type lectins 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025896   Gene: ENSGGOG00000022096   Transcript: ENSGGOT00000034271
Sequence length 248
Comment pep:known_by_projection chromosome:gorGor3.1:10:92368750:92373242:1 gene:ENSGGOG00000022096 transcript:ENSGGOT00000034271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLCPLALTLILMAASGAACEVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPM
GPPGEMPCPPGNDGLPGAPGVPGECGEKGEPGERGPPGVPAHLDEELQATLHDFRHQILQ
TRGALSLQGSIMTVGEKVFSSNGQSVTFDAIQEACARAGGRIAVPRNPEENEAIASFVKK
YNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLY
SRLTICEF
Download sequence
Identical sequences G3SCR8
ENSGGOP00000025896 XP_004049694.1.27298 XP_004049696.1.27298 ENSGGOP00000025896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]