SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025953 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025953
Domain Number 1 Region: 4-227
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 5.75e-52
Family Regulator of chromosome condensation RCC1 0.0063
Further Details:      
 
Domain Number 2 Region: 625-730
Classification Level Classification E-value
Superfamily POZ domain 5.97e-21
Family BTB/POZ domain 0.0085
Further Details:      
 
Domain Number 3 Region: 402-503
Classification Level Classification E-value
Superfamily POZ domain 6.48e-17
Family BTB/POZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025953   Gene: ENSGGOG00000016682   Transcript: ENSGGOT00000033486
Sequence length 1214
Comment pep:known_by_projection chromosome:gorGor3.1:6:82120788:82183133:-1 gene:ENSGGOG00000016682 transcript:ENSGGOT00000033486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPTDVYTWGDNTNFTLGHGSQNSKHHPELVDLFSRSGIYIKQVVLCKFHSVFLSQKGQVY
TCGHGPGGRLGHGDEQTCLVPRLVEGLNGHNCSQVAAAKDHTVVLTEDGCVYTFGLNIFH
QLGIIPPPSSCNVPRQIQAKYLKGRTIIGVAAGRFHTVLWTREAVYTMGLNGGQLGCLLD
PNGEKCVTAPRQVSALHHKDIALSLVAASDGATVCVTTRGDIYLLADYQCKKMASKQLNL
KKVLVSGGHMEYKVDPEHLKENGGQKICILAMDGAGRVFCWRSVNSSLKQCRWAYPRQVF
ISDIALNRNEILFVTQDGEGFRGRWFEEKRKSSEKKEILSNLHNSSSDVSYVSDINSVYE
RIRLEKLTFAHRAVSVSTDPSGCNFAILQSDPKTSLYEIPAVSSSSFFEEFGKLLREADE
MDSIHDVTFQVGNRLFPAHKYILAVHSDFFQKLFLSDGNTSEFTDIYQKDEDSAGCHLFV
VEKVHPDMFEYLLQFIYTDTCDFLTHGFKPRIHLNKNPEEYQGTLNSHLNKVNFHEDDNQ
KSAFEVYKSNQAQTVSERQKSKPKSCKKGKNIREDDPVRMLQTVAKKFGFSNLSSRLDGV
IFENEKINVIAKNTGNKLKLSQKKCSFLCDVTMKSVDGKEFPCHKCVLCARLEYFHSMLS
SSWIEASSCAALEMPIHSDILKVILDYLYTDEAVVIKESQNVDFICSVLVVADQLLITRL
KEICEVALTEKLTLKNAAMLLEFAAMYSAKQLKLSCLQFIGLNMAALLEARSLDVLSDGV
LKDLSEFYRKMIPAMDRRVITPYQDGPDISYLEVEDGDIFLKEEINMEQNHSETMFKKAK
TKAKKKPRKRSDSSGGYNLSDIIQSPSSTGLLKSGKTNSVESLPELLTSDSEGSYAGVGS
PRDLQSPDFTTGFHSDKIEAKVKPYVNGTSPVYSREDLKPWEKSPILKISAPQPIPSNRI
DTTSSASWVAGSFSPVSPPVVDLRTIMEIEESRQKCGATPKSHLGKTVSHGVKLSQKQRK
MIALTTKENNSGINSMETVLSTPSKAPKPVNAWASSLHSVSSKSFRDFLLEEKKSVTSHS
SGDHVKKVSFKGIENSQAPKIVRCSTDGTPGPEGNHISDLPLLDSPNPWLSSSVTAPSMV
APVTFASIVEEELQQEAALIRSREKPLALIQIEEHAIQDLLVFYEAFGNPEEFVIVERTP
QGPLAVPMWNKHGC
Download sequence
Identical sequences ENSGGOP00000025953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]