SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025967 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025967
Domain Number 1 Region: 51-271,427-536,571-634
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.22e-42
Family Quinoprotein alcohol dehydrogenase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025967   Gene: ENSGGOG00000004648   Transcript: ENSGGOT00000033880
Sequence length 861
Comment pep:novel chromosome:gorGor3.1:16:4585666:4646781:-1 gene:ENSGGOG00000004648 transcript:ENSGGOT00000033880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAWISDIRAGTAPSCRNHIKSSCSLIAFNSDCPGVLGIVPLQGQGEDKRRVAHLGCHSDL
VTDLDFSPFDDFLLATGSADRTVKLWRLPGPGQALPSAPGVVLGPEDLPVEVLQFHPTSD
GILVSAAGTTVKVWDAAKQQPLTELAAHGDLVQSAVWSRDGALVGTACKDKQLRIFDPRT
KPQASQSMQAHENSRDSRLAWMGTWEHLVSTGFNQMREHEVKLWDTRFFSSALASLTLDT
SLGCLMPLLDPDSGLLVLAGKGERQLYCYEVVPQQPALSPVTQCVLESVLRGAALVPRQA
LAVMSCEVLRVLQPSLSSVTETEKHVEHKEGTCTEPAAATCCPRGLKLGCFPVCLRLCPC
PPPLLSHAHSGGSSSPEGFSSPPSSLTSPSTPSSLGPSLSSTSGIGTSPSLRSLQSLLGP
SSKFRHAQGTVLHRDSHITNLKGLNLTTPGESDGFCANKLRVAVPLLSSGGQVAVLELRK
PGRLPDTALPTLQNGAAVTDLAWDPFDPHRLAVAGEDARIRLWRVPTEGLEEVLTTPETV
LTGQAGSGLALRRRGASSEERGASTVSHIPSCPQIFSLAWSPDGQQLATVCKDGRVRVYR
PRSGPEPLQEGPGPKGGRGARIVWVCDGRCLLVSGFDSQSERQLLLYEAEALAGGPLAVL
GLDVAPSTLLPSYDPDTGLVLLTGKGDTRVFLYELLPESPFFLECNSFTSPDPHKGLVLL
PKTECDVREVELMRCLRLRQSSLEPVAFRLPRVRKEFFQDDVFPDTAVSWEPVLSAEAWL
QGANGQPWLLSLQPPDMSPVSQAPREAPARRAPSSAQYLEKKSDQQKKEELLNAMVAKLG
NREDPLPQDSFEGVDEDEWWD
Download sequence
Identical sequences ENSGGOP00000025967 ENSGGOP00000004563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]