SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026034 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026034
Domain Number 1 Region: 142-228
Classification Level Classification E-value
Superfamily Immunoglobulin 1.48e-18
Family I set domains 0.052
Further Details:      
 
Domain Number 2 Region: 66-139
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000018
Family V set domains (antibody variable domain-like) 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026034   Gene: ENSGGOG00000027754   Transcript: ENSGGOT00000025622
Sequence length 285
Comment pep:novel chromosome:gorGor3.1:19:48542508:48548411:1 gene:ENSGGOG00000027754 transcript:ENSGGOT00000025622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTCRCCYCCPCCGQGPGYGSKNPAASAGVSDCTGGFVCPRALHFLPSHTLLRQEFPSSWL
LVPGRTLCIRGLSATNKLDQEVQEETQGRFRLLGDLSRNNCSLSIVDARRRDNGSYFFRM
ERGSTKHSYKSPQLSVHVTALTHRPSIFIPRTLESGHPRNLTCSVPSACEQGTPPIFSWM
SAAPISLGPRTLHSSVLTIIPRPQDHGTNLTCRVTFPRAGVTTERTIQLSVSWKSRPVTK
VVLVAIGEAAVKILFLCLCLTFLRSCRRKVAKAAAAVEAENTAMG
Download sequence
Identical sequences ENSGGOP00000026034 ENSGGOP00000026034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]