SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026162 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026162
Domain Number 1 Region: 25-200
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.36e-68
Family MHC antigen-recognition domain 0.00000543
Further Details:      
 
Domain Number 2 Region: 204-285
Classification Level Classification E-value
Superfamily Immunoglobulin 8.29e-23
Family C1 set domains (antibody constant domain-like) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026162   Gene: ENSGGOG00000022903   Transcript: ENSGGOT00000030376
Sequence length 341
Comment pep:known_by_projection chromosome:gorGor3.1:1:160539163:160560695:1 gene:ENSGGOG00000022903 transcript:ENSGGOT00000030376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGELMAFLLPLIIVLMVKHSDSRTHSLRYFRLGISDPIHGVPEFISVGYVDSHPITTYDS
VTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGC
ELLEDGSTTGFLQYAYDGQDFLIFSKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLE
EECIAWLKRFLEYGKDTLQRTEPPVVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNG
EEIVQEIDYGDILPSGDGTYQTWASVELDPQSSNLYSCHVEHCGVHMVLQVPQESETIPL
VMKAVSGSIVLVIVLAGVGVLVWRRRPREQNGAIYLPTPDR
Download sequence
Identical sequences G3SDI2
ENSGGOP00000026162 XP_004028051.1.27298 ENSGGOP00000026162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]